2014 Salıklı Beslenme ve Hareket Yılı

0
1164
www.diyetisyenstore.com

Yazar : Öğr. Dyt. Maria Tanoglu
İstanbul Arel Üniveristesi Beslenme ve Diyetetik Bölümü Öğrencisi

              2014  SAĞLIKLI  BESLENME VE  HAREKET  YILI !

2014 yılı;Sağlık Bakanı Mehmet Müezzinoğlu tarafından Sağlıklı Beslenme ve Hareket Yılı ilan edildi.

Obezitenin küresel boyutlarda yaygınlaşarak bir halk sağlığı sorunu haline gelmesi  tüm dünyada olduğu gibi Türkiyede de obezite ile mücadele çalışmalarının başlamasına neden oldu.

20 yaş ve üzeri her iki cinsiyetteki erişkinlerin  ortalama olarak   %57.4’ü
obez  yada  fazla  kilolu

http://www.gencdiyetisyenler.com/wp-content/uploads/2014/08/1-turkiyedeki-obezite-tehlikesi.jpg     Yapılan  araştırmalar   dünya  genelinde  olduğu  gibi ülkemizde de  fazla  kilolu  olma  ve  obezite sıklığının giderek arttığını , obezitenin özellikle çocuklarımızı ve gençlerimizi etkisi altına almaya başladığını göstermektedir.  Öyleki Dünyada obezite prevalansı 1980 ve 2008 yılları arasında neredeyse iki katına çıkmıştır.  Avrupa bölgesinde 2008 yılı için kadınların ve erkeklerin %50’den fazlası fazla kiloludur ve neredeyse kadınların %23’ü, erkeklerin %20’si  obezdir(2).

Türkiyede Obezitenin Görülme Sıklığı

Türkiye Beslenme ve  Sağlık Araştırması-2010”ön  çalışma raporuna göre ;

  • Erkeklerde %20,5
  • Kadınlardaise % 41,0
  • Toplamda % 30,3 olarak bulunurken,

http://www.gencdiyetisyenler.com/wp-content/uploads/2014/08/2.jpg

Çocuklarda  ve  Adölesanlarda

  • 0-5 yaşta fazla kilolu olanlar %17,9, fazla kilolu ve şişman olanlar %26,4
  • 6-18 yaşta fazla kilolu olanlar %14,3, fazla kilolu ve şişman olanlar %22,5 olarak bulunmuştur.

NEDEN ?

Son yıllarda ülkemizde, özellikle kentsel bölgelerde çocuk ve gençler arasında ayaküstü beslenmenin (fast-food)  sıklıkla tercih edilen bir beslenme şekli olduğu görülmektedir. Fast –food ; enerjisi ve tuz içeriği yüksek  ancak  posa içeriği,  A , C vitaminleri ve kalsiyum yönünden yetersiz bir beslenme biçimidir. Bu nedenle sıklığı yetersiz ve dengesiz beslenmeye neden olarak obezite,  kalp-damarhastalıkları, diyabet gibi kronik hastalıkların oluşma riskini artırmaktadır. Çocukluk çağı obezitesinin artışında; değişen çevresel faktörlerin etkisiyle çocuk ve gençlerin daha az hareketli bir yaşam tarzını benimsemelerinin etkisi oldukça fazladır

 

  Obezite NEDİR ?  Kimler obezite riski altındadır?            

       21.Yüzyılın Küresel Boyutta En Önemli Halk Sağlığı Sorunu

<<<OBEZİTE  >>>

 

Sınıflandırma BKİ (kg/m2)
Zayıf (düşükağırlıklı)
Aşırıdüzeydezayıflık
Ortadüzeydezayıflık 16.00 – 16.99
Hafifdüzeydezayıflık 17.00 – 18.49
Normal 18.50 – 24.99
Toplu, hafifşişman, fazla kilolu > 25.00
Şişmanlıköncesi (Pre-obez) 25.00 – 29.99
Şişman (Obez) > 30.00
Şişman I. Derece 30.00 – 34.99
Şişman II. Derece 35.00 – 39.99
Şişman III. Derece > 40.00

Obezite, vucutta sağlığı bozacak ölçüde anormal veya aşırı yağ birikmesidir.

Obezite nasıl saptanır ?

Obeziteyi belirlemek için yaygın olarak Beden Kitle İndeksi (BKİ) kullanılmaktadır. BKİ, bireyin vücut ağırlığının (kg), boy uzunluğunun (m cinsinden ) karesine (BKI=kg/m2) bölünmesiyle elde edilen bir değerdir. BKİ boy uzunluğuna göre vücut ağırlığının tahmin edilmesinde kullanılmakta, vücutta yağ dağılımı hakkında bilgi vermemektedir.

Örneğin :1. 65 m boyunda ve 90 kg ağırlığında olan bir yetişkinin BKİ’sini hesaplayalım.

BKİ =   90 / 1.65×1.65 = 33,05  işlemini yaparak bu kişinin BKİ’sinin 33 olduğunu buluruz

 

Yetişkinlerde BKİ’ye göre zayıflık ,fazla kiloluk ve obezite sınıflandırılması

                    OBEZİTENİN  VE FİZİKSEL AKTİVİTE YETERSİZLİĞİNİN

                                            HASTALIKLARLA İLİŞKİSİ

Obezite ;vücut sistemleri (endokrin sistem, kardiyovasküler sistem, solunum sistemi, gastrointestinal sistem, deri, genitoüriner sistem, kas- iskelet sistemi) ve psikolojik olarak pek çok sağlık sorunlarına neden olmaktadır.Bu sağlık sorunlarını daha da açacak olursak

OBEZİTE;

•İnsülin direnci – Hiperinsülinemi

•Tip 2 Diyabet

•Hipertansiyon

•Koroner arter hastalığı

•Hiperlipidemi – Hipertrigliseridemi

•Metaboliksendrom

•Safra kesesi hastalıkları

•Bazı kanser türleri (kadınlarda safra kesesi, endometriyum, yumurtalık ve meme kanserleri, erkeklerde ise kolon ve prostat kanserleri )

•Osteoartrit

•Felç

•Uyku apnesi

•Karaciğer yağlanması

•Astım

•Solunum zorluğu

•Gebelik komplikasyonları

•Menstruasyon düzensizlikleri

•Aşırı kıllanma

•Ameliyat risklerinin artması

•Ruhsal sorunlar (Anoreksiya nevroza (yemek yememe) veya Blumia nevroza (kusarak yediği besinlerden yararlanmama), Bingeeating (tıkınırcasına yeme) , gece yeme sendromu veya bir şeyi daha fazla yiyerek psikolojik doyum sağlamaya çalışma)

•Kas-iskelet sistemi problemleri

gibi sağlık sorunlarına/risk faktörlerine neden olmaktadır.

2008 yılında dünya çapında meydana gelen 57 milyon ölümden 36 milyonu yani %63’ü; kardiyovasküler hastalıklar, diyabet, kanserler ve kronik solunum yolu hastalıkları gibi bulaşıcı olmayan  hastaklıklardan (BOH) kaynaklanmıstır. (2) BOH’ların büyük bir kısmı, 4 temel davranıssal risk faktörünün azaltılmasıyla önlenebilir: tütün kullanımı, hareketsizlik, alkolün zararlı kullanımı ve sağlıksız beslenme.(2)

Gelin şimdi fazla kilo, obeziteve   fiziksel aktivite yetersizliğinin  küresel BOH epidemisi üzerindeki etkilerine birlikte  göz atalım.

  • Obeziteyle mücadeleyle  önlenebilecek ölüm sayıları iskemik kalp hastalığında 29.581, iskemik    inmede 11.109, diyabette 7.674’dür. Toplamda ise 57.143 ölüm önlenebilmekte olup bu tüm ölümlerin %13.3’ünü oluşturmaktadır. (5)
  • Dünya Kanser Araştırma Fonu başlıca kanserlerin %27-39 kısmının beslenmeyi, fiziksel aktiviteyi ve vücut kompozisyonunu geliştirerek önlenebileceğini belirtmektedir .(3)
  • Kalp hastalıgı, felç ve diyabet riskleri; beden kütle indeksinin (BKİ) artmasına bağlı olarak giderek artmaktadır. BKİ ’nin artması belli kanserlere ilişkin riski arttırmaktadır.(2)

Sağlıklı Beslenme ve Fiziksel Aktiviteyle Hastalık Risklerini Azaltmak Mümkün

PEKİ  NASIL BESLENMELİYİZ ?

Etkileri anne karnından başlayıp  yaşamın sonuna kadar devam eden ve (canlılığın devamı için) yaşamsal faaliyetlerimiz için temel oluşturan beslenme ; oldukça kişiye özgü ve  kapsamlı bir konudur.Son yıllarda artan obezitenin  başlıca nedenlerinden biride beslenme konusunda yaptığımız yanlışlardan    kaynaklanmaktadır.Yeterli ve dengeli beslenme kavramı; sağlıklı beslenmenin temelini oluşturur.

Yeterli ve dengeli  beslenme ; bütün  besin ögelerinin yeterli ve  dengeli ölçüde tüketilmesini esas alır..Yeterli ve dengeli beslenmede bize temel oluşturacak 4 ana besin grubumuz bulunmaktadır. Bu besin grupları ; benzer içerikteki besin ögelerinin bir araya gelmesiyle oluşur.Besinlerin bu şekilde gruplanması ; 4 ana besin  grubundan  dengeli bir şekilde beslenmemize yol açarken  grup içerinde  gıda  çeşitliliğine de  olanak sağlar.Hadi gelin şimdi  sağlıklı beslenmede  bize temel oluşturacak 4 besin grubumuzu tanırken,  bunları ne kadar tüketmemiz gerektiği  ve bize faydalarını konusunda bilgi sahibi olalım.

SÜT GRUBU

*Süt grubu ;  Süt ve süt yerine geçen; yoğurt, peynir ve süttozu gibi besinleri kapsar.

*Protein,  fosfor, B2 vitamini (riboflavin)   B12 vitamini ve özellikle kalsiyumdan zengindir.

*Yetişkin bireyler; Günde    2 porsiyon,

http://www.gencdiyetisyenler.com/wp-content/uploads/2014/08/3.jpgÇocuklar ,adölesan dönemi gençler, gebe, emzikli kadınlar ve menopoz sonrası kadınlar günde 3-4 porsiyon süt ve yerine geçen besinleri tüketmelidir.

1 porsiyon =Bir orta boy su bardağı (200 ml) süt veya yoğurt yada  iki kibrit kutusu büyüklüğünde peynirdir.

*Kemiklerin ve dişlerin sağlıklı gelişiminde ve hücre çalışmasında önemli rol oynar.İshal tedavisinde yoğurt yenmesi ve tuzluayraniçilmesiyaşamkurtarır.

ET-YUMURTA-KURUBAKLAGİL GRUBU

*Et, tavuk, balık, yumurta, kuru fasulye, nohut, mercimek gibi besinlerin bulunduğu bu grupta  ceviz, fındık, fıstık gibi yağlı tohumlar da yer almaktadır.

*Protein, demir, çinko, fosfor, magnezyum, B6, B12, B1 ve A vitamini, posa (kurubaklagiller) içerir.

Hücre yenilenmesi, doku onarımı ve görme işlevinde ,kan yapımında ve hastalıklara karşı direnç kazanılmasında rolü olan en önemli besin grubudur.

Sinir, sindirim sistemi ve deri sağlığında  görev alan en önemli besin öğeleri bu grupta bulunur.

 

SEBZE VE MEYVE GRUBU

*Tüm meyve ve sebzeler

;  içerdikleri besin öğeleri ve miktarı bakımından farklıdırlar. Bu nedenle meyve ve sebze tüketiminde çeşitlilik çok önemlidir.

*Günde en az 5 porsiyon meyve ve sebze tüketilmelidir.

1 porsiyon meyve = 1orta boy elma veya 1 orta boy portakal veya 1 büyük boy mandalina

1 porsiyon sebze = 4-5 yemek kaşığı sebze yemeği veya 1 kase salata

*Bileşiminlerinin %75-90’ı su olan meyve ve sebzeler ; deyim yerindeyse tam bir vitamin deposudur.Vitamin gereksinimimizin  % 90’nını meyve sebzelerden karşılarız.

Folik asit, A vitaminin ön ögesi olan beta-karoten, E, C, B2 vitamini, kalsiyum, potasyum, demir, magnezyum, posa ve diğer antioksidan özelliğe sahip bileşiklerden  zengindirler.

*Barsakların düzenli çalışmasında,hücre yenilenmesinde , doku onarımında  görev alırlar.Deri ,göz, diş ve diş eti sağlığı için temel ögeler içerirler.

Günde 400 gr  meyve ve sebze tüketimi(günde en az 5 porsiyon) ; kardiyovasküler hastalık, mide kanseri ve kolorektal kanser riskini azaltabilirsin. (2)

EKMEK ve TAHIL GRUBU

*Buğday, pirinç, mısır, çavdar ve yulaf gibi tahıl taneleri ve bunlardan yapılan un, bulgur, yarma, gevrek ve benzeri ürünler bu grup içinde yer alır.

*Tahıl ve tahıl ürünleri vitaminler, mineraller, karbonhidratlar (nişasta, lif) ve diğer besin öğelerini içermeleri nedeniyle sağlık açısından önemli besinlerdir. Tahıllar, protein de içerir.Tahıllar B12 dışındaki B grubu vitaminlerinden zengin, özellikle B1 vitaminin (tiamin) en iyi kaynağıdır.Folik asit, A vitaminin ön öğesi olan beta-karoten, E, C, B2 vitamini, kalsiyum, potasyum, demir, magnezyum, posa ve diğer antioksidan özelliğe sahip bileşiklerden zengindirler.

*Tam tahıl ürünlerini tüketin.

Tüketilecek ekmek miktarı bireyin ağırlık ve bedensel çalışma durumuna göre değişir.Az hareketli, şişman bireylere günde 3 ince dilim ekmek (75 g) yeterli iken zayıf bireyler, ağır işte çalışanlarbunun 3-5 katınıyiyebilirler.

Tam tahıl ürünleri günde 6 porsiyon tüketilebilir. (6)

1 porsiyon = 1 dilim ekmek veya 1 kase çorba = 2 yemek kaşığı bulgur pilavı

Besinler ilacınız, ilacınız besininiz olsun…

  • Yeterli miktarda posalı besin (DSÖ ‘ye göre günlük ortalama  30  gr  posa tüketilmelidir.)  tüketimiyle kabızlık sorunu ,kolon-rektum kanseri , diyabet riskini azaltabilirsin.
  • Dünya sağlık örgütünün önerisine uyarak günlük ortalama  5 gram kadar tuz tüketimiyle kardiyovaskülerhastalıklarıönleyebilirsin.
  • Yeterli miktarda  posalı besin (DSÖ’ye göre günlük ortalama 30 gr)   tüketimiyle  kabızlık sorunu , kolon-rektum kanseri , diyabet riskini azaltabilirsin. (Başlıca posa kaynakları: kurubaklagiller, sert kabuklu meyveler, tam tahıllı  ürünler, sebzeler)
  • Su, insan yaşamı için oksijenden sonra gelen en önemli öğedir ve beslenmemizin vazgeçilmez bir parçasıdır.  Yapılan çalışmalara göre uygun miktarlarda günlük su tüketerek  (8-10 bardakortalama 2.5 litre) kabızlık, idrar yolu enfeksiyonları, cilt sağlığının korunması, organizmanın toksinlerden arındırılması,  kilo kontrolü programlarında zayıflamaya yardımcı olması, cildin nem ve elastikiyetinin düzenlenmesinde rol oynaması nedenleriyle selülit oluşumunun önlenmesinde yardımcı olabilirsin.
  • Fizikselaktivite;  felç, hipertansiyonvedepresyonriskini de azalttır.

Haftadaortalama  150dakikalıkortasiddetlifizikselaktiviteyleiskemikkalphastalıgıriskiniyaklasık %30, diyabetriskini %27, meme vekolonkanseririskini %21-25 azalttabilirsin. (2)

Uzun, sağlıklı ve mutlu bir yaşam beklentisi içindeki  21. yüzyıl insanı için; obeziteyi önlemek ve fiziksel faaliyetlerde bulunmak sayısal verilerle de aktarmaya çalıştığım gibi birçok hastalık riskinin engellenmesinde çok büyük önem taşımaktadır. Obezitenin giderek artış gösteren ciddi bir halk sağlığı sorunu haline geldiği bu süreçte bizler yeterli ve dengeli beslenmenin hayatımızdaki öneminin farkına varıp sağlıklı beslenmeyi bir alışkanlık haline getirerek fiziksel aktiviteye hayatımızda hak ettiği yeri vermeliyiz.

KAYNAKÇA

1) Türkiye Sağlıklı Beslenme ve Hareketli Hayat Programı Sağlık Bakanlığı, Türkiye Halk Sağlığı Kurumu, 773, Ankara, 2013

2)Bulaşıcı Olmayan Hastalıklara İlişkin Küresel Durum Raporu, Dünya SaglıkÖrgütü ,İtalya , 2011

3)Policyandactionforcancerprevention. Food, nutrition, andphysicalactivity: a global perspective.

Washington, DC, World cancerresearchfund/americaninstituteforcancerresearch, 2009.

4)T.C Sağlık Bakanlığı, Türkiye Halk Sağlığı Kurumu – Obezite, Diyabet ve Metabolik Hastalıklar Daire Başkanlığı, Obezitenin Yol Açtığı Sağlık Problemleri, http://www.beslenme.gov.tr/

5)T.C. Sağlık Bakanlığı, Temel Sağlık Hizmetleri Genel Müdürlüğü, Türkiye’de Bulaşıcı Olmayan Hastalıklar ve Risk Faktörleri ile Mücadele Politikaları Ankara, 809, 2011.

6) T.C. Sağlık Bakanlığı TemelSağlık HizmetleriGenelMüdürlüğü,Türkiye’ye Özgü Beslenme Rehberi,Ankara,2004

 

ÖĞR.DİYETİSYEN : MARİA TANOĞLU

Ş.Oymak , 26 Ocak 2014 ,www.aa.com.tr

(Dünya Sağlık Örgütü  (WHO)  Küresel Sağlık İzleme Veri Havuzu’ndan elde edilen verilere göre)

Dünya Sağlık Örgütü

 

Not : Bu makaleyi word olarak indirmek için lütfen burayı tıklayınız.

NOt :  Bu paylaşım web yarışmamız çerçevesinde puanlandırılmaya başlanmıştır.

______________________________________________

Sitemizde makale / yazı yayınlamak için burayı tıklayınız.

Sitemizde sunum eklemek için burayı tıklayınız.

Sitemizde Diyetisyen Arıyoruz ilanı eklemek için burayı tıklayınız.

Sitemizde Diyetisyenim İş Arıyorum ilanı vermek için burayı tıklayınız.

Sitemizde ikinci el ilan eklemek için burayı tıklayınız.

Sitemizde video yayınlamak için burayı tıklayınız.

Sitemizde haber eklemek için  burayı tıklayınız.

mail-grubu